PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0122049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 153aa    MW: 17150.5 Da    PI: 4.4199
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0122049.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.35.4e-251194386
            NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c re+r+ti+++ +l al+ lGf dy+e++ + 
  Lj0g3v0122049.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCGREERRTIAPEHVLKALGVLGFGDYIEEVYAA 94
                     6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.9E-399140IPR009072Histone-fold
SuperFamilySSF471132.18E-3512142IPR009072Histone-fold
PfamPF008081.2E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MEPMDIVAKA KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCGREERRTI APEHVLKALG VLGFGDYIEE VYAAYEQHKL ETMQDTLKGA KWSNRAEMTE  120
EEALAEQQRM FAEARARMNG GTITSKEPDA DQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-341213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.70500.0cell culture| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1410600.0BT141060.1 Lotus japonicus clone JCVI-FLLj-2C22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494002.11e-107PREDICTED: protein Dr1 homolog
SwissprotP495922e-89NC2B_ARATH; Protein Dr1 homolog
TrEMBLI3SKR21e-111I3SKR2_LOTJA; Uncharacterized protein
STRINGGLYMA05G07750.11e-98(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.21e-90nuclear factor Y, subunit B13